PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1777s0019.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 321aa    MW: 36793.4 Da    PI: 4.6241
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1777s0019.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.6e-092612932355
                          SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +yp++ ++  LA+++gL+++q+ +WF N+R ++
  Cagra.1777s0019.1.p 261 PYPTEGDKIALAEETGLDQKQINNWFINQRKRH 293
                          8*****************************885 PP

2ELK33.68.3e-12213234122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          +LK+qLlrK++++++sLk EFs
  Cagra.1777s0019.1.p 213 DLKDQLLRKFGSHISSLKLEFS 234
                          6********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.1E-2070114IPR005540KNOX1
PfamPF037901.8E-1972113IPR005540KNOX1
SMARTSM012564.0E-25122173IPR005541KNOX2
PfamPF037919.5E-25126172IPR005541KNOX2
PfamPF037897.5E-9213234IPR005539ELK domain
PROSITE profilePS512139.935213233IPR005539ELK domain
SMARTSM011884.2E-6213234IPR005539ELK domain
PROSITE profilePS5007112.698233296IPR001356Homeobox domain
SuperFamilySSF466892.22E-19234307IPR009057Homeodomain-like
SMARTSM003893.9E-13235300IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-27238297IPR009057Homeodomain-like
CDDcd000866.98E-12242297No hitNo description
PfamPF059201.5E-17253292IPR008422Homeobox KN domain
PROSITE patternPS000270271294IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0010094Biological Processspecification of carpel identity
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MDRMCGFRST ADYSEKPALM MIPSDYQSLL CSSAGDNRQF GSDELATALS SERPSTAPRI  60
RKAEDNFSLS LIKSKISCHP LYPRLLQTYI DCQKVGAPME ITCILEEIQR ENDVYKKRDA  120
TLMSCFGDDP DLDEFMETYC DILVKYKSDL ARPFDEATNF LNKIETQLQN LCIGPVSVTG  180
LSDDGVVSSD EELREDDDNV EAHESQQISN DRDLKDQLLR KFGSHISSLK LEFSKKKKKG  240
KLPREARQAL LDWWNVHYTW PYPTEGDKIA LAEETGLDQK QINNWFINQR KRHWKPSENM  300
PFAMMDDPSE ILFTENEKET *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301623.10.0hypothetical protein CARUB_v10022064mg
SwissprotP466400.0KNAT2_ARATH; Homeobox protein knotted-1-like 2
TrEMBLR0GFW00.0R0GFW0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__1305__AT1G70510.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.10.0KNOTTED-like from Arabidopsis thaliana 2